PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00075507001
Common NameGSBRNA2T00075507001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 328aa    MW: 37495.7 Da    PI: 8.4733
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00075507001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.62.2e-3154107255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          prlrWtp+LH +Fv+av++LGG+++AtPk +l++m++kgL+++hvkSHLQ+YR+
  GSBRNA2T00075507001  54 PRLRWTPDLHLSFVRAVQRLGGPHRATPKMVLQMMNLKGLSIAHVKSHLQMYRS 107
                          8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.60150110IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2850108IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-2254109IPR006447Myb domain, plants
SuperFamilySSF466891.52E-1354108IPR009057Homeodomain-like
PfamPF002492.8E-855106IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MDGTSSPEKC SMWLDLNREE AVEKYNEEES SVEDEDQQVT SSNNVRQYVR SNMPRLRWTP  60
DLHLSFVRAV QRLGGPHRAT PKMVLQMMNL KGLSIAHVKS HLQMYRSKKL EATSLHADVG  120
AMMGAQRNYL LDMIDIPYGD LRHAYYPKTV PSRVRNQDAI FTNLGTNFVM RPSSWCNRLS  180
GHELNNGRGE LDRDSMESKT LPLLEEDDPR EKSPRRSGKR SIISQTIKTN ARRWDQHDAL  240
AVSVLDIIRR VTVVMASDIV ETIWVRLDSD PKLSVDKLMR ETDNIRFRAD RSSVESSLGL  300
RLRKRTCLAL ETASLIEQGF DCIFNCL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1214220RRSGKRS
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00075507001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013683772.11e-141PREDICTED: uncharacterized protein LOC106388284
RefseqXP_013627361.11e-141PREDICTED: uncharacterized protein LOC106333463
TrEMBLA0A078HWH90.0A0A078HWH9_BRANA; BnaC03g23810D protein
STRINGBra000270.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.13e-90G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]